Host taxon 9606
Protein NP_001254703.1
intraflagellar transport protein 20 homolog isoform 1
Homo sapiens
Gene IFT20, UniProt Q8IY31
>NP_001254703.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|intraflagellar transport protein 20 homolog isoform 1
MTHLLLTATVTPSEQNSSREPGWETAMAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.78 | -0.780673846289794 | 0.023 | 25649146 | |
Retrieved 1 of 3 entries in 2.4 ms
(Link to these results)