Host taxon 9606
Protein NP_036407.1
interleukin-36 receptor antagonist protein
Homo sapiens
Gene IL36RN, UniProt Q9UBH0
>NP_036407.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|interleukin-36 receptor antagonist protein
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ -2.25 | -2.24748620465106 | 0.025 | 25649146 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)