Host taxon 9606
Protein NP_000576.1
interleukin-15 isoform 1 preproprotein
Homo sapiens
Gene IL15, UniProt P40933
>NP_000576.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|interleukin-15 isoform 1 preproprotein
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●●● 5.06 | 5.06390766964263 | 0.02 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)