Host taxon 9606
Protein NP_009110.2
insulin-like peptide INSL6 precursor
Homo sapiens
Gene INSL6, UniProt Q9Y581
>NP_009110.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|insulin-like peptide INSL6 precursor
MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.01 | 2.00717893291364 | 0.00048 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)