Host taxon 9606
Protein NP_002169.1
insulin-like growth factor-binding protein 6 precursor
Homo sapiens
Gene IGFBP6, UniProt P24592
>NP_002169.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|insulin-like growth factor-binding protein 6 precursor
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.51 | 1.5123182118085 | 0.037 | 25649146 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)