Host taxon 9606
Protein NP_057181.1
immediate early response 3-interacting protein 1 precursor
Homo sapiens
Gene IER3IP1, UniProt Q9Y5U9
>NP_057181.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|immediate early response 3-interacting protein 1 precursor
MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNSIAIVLLLLFG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.83 | -0.826206818115228 | 0.001 | 25649146 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)