Host taxon 9606
Protein NP_001332933.1
IGF-like family receptor 1 isoform c precursor
Homo sapiens
Gene IGFLR1, UniProt Q9H665
>NP_001332933.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|IGF-like family receptor 1 isoform c precursor
MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAYSLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.04 | 1.03959762381978 | 0.0056 | 25649146 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)