Host taxon 9606
Protein NP_002097.1
histone H2A.Z
Homo sapiens
Gene H2AZ1, UniProt P0C0S5
>NP_002097.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|histone H2A.Z
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.02 | -1.02281878560544 | 0.00026 | 25649146 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)