Host taxon 9606
Protein NP_001317119.1
high mobility group protein HMGI-C isoform 3
Homo sapiens
Gene HMGA2, UniProt P52926
>NP_001317119.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|high mobility group protein HMGI-C isoform 3
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWEEFYIAA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.74 | -0.743412069453901 | 0.048 | 25649146 | |
Retrieved 1 of 4 entries in 1.3 ms
(Link to these results)