Host taxon 9606
Protein NP_001124160.1
high mobility group protein B2
Homo sapiens
Gene HMGB2, UniProt P26583
>NP_001124160.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|high mobility group protein B2
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.16 | -1.16148675229484 | 0.0028 | 25649146 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)