Host taxon 9606
Protein NP_001291438.1
haloacid dehalogenase-like hydrolase domain-containing protein 3
Homo sapiens
Gene HDHD3, UniProt Q9BSH5
>NP_001291438.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|haloacid dehalogenase-like hydrolase domain-containing protein 3
MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.07 | 1.06691625987699 | 0.00058 | 25649146 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)