Host taxon 9606
Protein NP_001030005.1
H/ACA ribonucleoprotein complex subunit 2 isoform b
Homo sapiens
Gene NHP2, UniProt Q9NX24
>NP_001030005.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|H/ACA ribonucleoprotein complex subunit 2 isoform b
MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGTWVQPQAPSAPPV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.57 | -0.565442585077121 | 0.014 | 25649146 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)