Host taxon 9606
Protein NP_002089.4
guanylyl cyclase-activating protein 2
Homo sapiens
Gene GUCA1B, UniProt Q9UMX6
>NP_002089.4|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|guanylyl cyclase-activating protein 2
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.44 | -1.44195827095336 | 2.0e-5 | 25649146 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)