Host taxon 9606
Protein NP_002862.2
guanine nucleotide exchange factor MSS4
Homo sapiens
Gene RABIF, UniProt P47224
>NP_002862.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|guanine nucleotide exchange factor MSS4
MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.79 | 0.790213515994824 | 0.012 | 25649146 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)