Host taxon 9606
Protein NP_660156.1
GTP-binding protein Di-Ras1
Homo sapiens
Gene DIRAS1, UniProt O95057
>NP_660156.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|GTP-binding protein Di-Ras1
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.49 | -1.48841955133448 | 0.019 | 25649146 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)