Host taxon 9606
Protein NP_036215.1
GSK-3-binding protein FRAT2
Homo sapiens
Gene FRAT2, UniProt O75474
>NP_036215.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|GSK-3-binding protein FRAT2
MPCRREEEEEAGEEAEGEEEEDDSFLLLQQSVTLGSSGEVDRLVAQIGETLQLDAAQDSPASPCAPPGVPLRAPGPLAAAVPADKARPPAVPLLLPPASAETVGPAPSGALRCALGDRGRVRGRAAPYCVAEVAAGPSALPGPCRRGWLRDAVTSRRLQQRRWTQAGARAGDDDPHRLLQQLVLSGNLIKEAVRRLQRAVAAVAATGPASAPGPGGGRSGPDRIALQPSGSLL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.31 | -1.30662115479407 | 0.0011 | 25649146 | |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)