Host taxon 9606
Protein NP_056490.2
growth arrest and DNA damage-inducible protein GADD45 beta
Homo sapiens
Gene GADD45B, UniProt O75293
>NP_056490.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|growth arrest and DNA damage-inducible protein GADD45 beta
MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.77 | -0.774587862229336 | 0.0095 | 25649146 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)