Host taxon 9606
Protein NP_000572.2
glutathione peroxidase 1 isoform 1
Homo sapiens
Gene GPX1, UniProt P07203
>NP_000572.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|glutathione peroxidase 1 isoform 1
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.28 | 0.279189871108652 | 0.022 | 25649146 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)