Host taxon 9606
Protein NP_057501.2
glutaredoxin-related protein 5, mitochondrial precursor
Homo sapiens
Gene GLRX5, UniProt Q86SX6
>NP_057501.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|glutaredoxin-related protein 5, mitochondrial precursor
MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.86 | -0.861232347076859 | 0.00018 | 25649146 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)