Host taxon 9606
Protein NP_001229557.1
glucose-fructose oxidoreductase domain-containing protein 1 isoform 2
Homo sapiens
Gene GFOD1, UniProt Q9NXC2
>NP_001229557.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|glucose-fructose oxidoreductase domain-containing protein 1 isoform 2
MTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.2 | -1.20286674092832 | 6.3e-5 | 25649146 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)