Host taxon 9606
Protein NP_009209.1
gamma-aminobutyric acid receptor-associated protein
Homo sapiens
Gene GABARAP, UniProt O95166
>NP_009209.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|gamma-aminobutyric acid receptor-associated protein
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.37 | 0.365923393407059 | 0.048 | 25649146 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)