Host taxon 9606
Protein NP_001263265.1
eukaryotic translation initiation factor 4E type 2 isoform C
Homo sapiens
Gene EIF4E2, UniProt O60573
>NP_001263265.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|eukaryotic translation initiation factor 4E type 2 isoform C
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.41 | -0.405461577622125 | 0.0086 | 25649146 | |
Retrieved 1 of 4 entries in 2.1 ms
(Link to these results)