Host taxon 9606
Protein NP_001135760.1
ER membrane protein complex subunit 8 isoform 2
Homo sapiens
Gene EMC8, UniProt O43402
>NP_001135760.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ER membrane protein complex subunit 8 isoform 2
MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.69 | 0.687585460623425 | 0.002 | 25649146 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)