Host taxon 9606
Protein NP_001953.1
ephrin-A5 precursor
Homo sapiens
Gene EFNA5, UniProt P52803
>NP_001953.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|ephrin-A5 precursor
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.1 | 1.10063172438999 | 0.015 | 25649146 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)