Host taxon 9606
Protein NP_055150.1
EP300-interacting inhibitor of differentiation 1
Homo sapiens
Gene EID1, UniProt Q9Y6B2
>NP_055150.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|EP300-interacting inhibitor of differentiation 1
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.54 | -0.538885185394226 | 0.0014 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)