Host taxon 9606
Protein NP_001029197.1
endoplasmic reticulum resident protein 29 isoform 2 precursor
Homo sapiens
Gene ERP29, UniProt P30040
>NP_001029197.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|endoplasmic reticulum resident protein 29 isoform 2 precursor
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKIMVTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.49 | -1.48890169012533 | 3.6e-17 | 25649146 | |
Retrieved 1 of 2 entries in 0.4 ms
(Link to these results)