Host taxon 9606
Protein NP_542408.1
dynein light chain 2, cytoplasmic
Homo sapiens
Gene DYNLL2, UniProt Q96FJ2
>NP_542408.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|dynein light chain 2, cytoplasmic
MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.91 | -0.909651087665613 | 0.0002 | 25649146 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)