Host taxon 9606
Protein NP_001293080.1
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform 2
Homo sapiens
Gene DAPP1, UniProt Q9UN19
>NP_001293080.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform 2
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLVKDKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●●○○ 2.09 | 2.08706717502027 | 6.7e-8 | 25649146 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)