Host taxon 9606
Protein NP_006433.2
dr1-associated corepressor
Homo sapiens
Gene DRAP1, UniProt Q14919
>NP_006433.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|dr1-associated corepressor
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.83 | -0.831067059113524 | 8.2e-6 | 25649146 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)