Host taxon 9606
Protein NP_068809.1
DNA-directed RNA polymerases I, II, and III subunit RPABC2 isoform 1
Homo sapiens
Gene POLR2F, UniProt P61218
>NP_068809.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA-directed RNA polymerases I, II, and III subunit RPABC2 isoform 1
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.01 | -1.00929319884185 | 0.004 | 25649146 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)