Host taxon 9606
Protein NP_001035737.1
DNA-directed RNA polymerase III subunit RPC9 isoform b
Homo sapiens
Gene CRCP, UniProt O75575
>NP_001035737.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA-directed RNA polymerase III subunit RPC9 isoform b
MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.91 | -0.911283351344738 | 3.5e-9 | 25649146 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)