Host taxon 9606
Protein NP_006225.1
DNA-directed RNA polymerase II subunit RPB11-a isoform 1
Homo sapiens
Gene POLR2J, UniProt P52435
>NP_006225.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA-directed RNA polymerase II subunit RPB11-a isoform 1
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.46 | -0.461508875498646 | 0.046 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)