Host taxon 9606
Protein NP_001159521.1
DNA excision repair protein ERCC-1 isoform 3
Homo sapiens
Gene ERCC1, UniProt P07992
>NP_001159521.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA excision repair protein ERCC-1 isoform 3
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.9 | -0.902115061309068 | 5.4e-5 | 25649146 | |
Retrieved 1 of 2 entries in 1.8 ms
(Link to these results)