Host taxon 9606
Protein NP_001006667.1
DNA dC->dU-editing enzyme APOBEC-3F isoform b
Homo sapiens
Gene APOBEC3F, UniProt Q8IUX4
>NP_001006667.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA dC->dU-editing enzyme APOBEC-3F isoform b
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.86 | 1.86484112412319 | 0.018 | 25649146 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)