Host taxon 9606
Protein NP_001181982.1
DNA damage-inducible transcript 3 protein isoform 1
Homo sapiens
Gene DDIT3, UniProt P35638
>NP_001181982.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|DNA damage-inducible transcript 3 protein isoform 1
MELVPATPHYPADVLFQTDPTAEMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.92 | -0.915858903495777 | 0.022 | 25649146 | |
Retrieved 1 of 2 entries in 2.1 ms
(Link to these results)