Host taxon 9606
Protein NP_001182572.1
dihydrofolate reductase 2, mitochondrial
Homo sapiens
Gene DHFR2, UniProt Q86XF0
>NP_001182572.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|dihydrofolate reductase 2, mitochondrial
MFLLLNCIVAVSQNMGIGKNGDLPRPPLRNEFRYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINLVLSRELKEPPQGAHFLARSLDDALKLTERPELANKVDMIWIVGGSSVYKEAMNHLGHLKLFVTRIMQDFESDTFFSEIDLEKYKLLPEYPGVLSDVQEGKHIKYKFEVCEKDD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.65 | -0.647387221449204 | 0.0021 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)