Host taxon 9606
Protein NP_001291708.1
derlin-2 isoform c
Homo sapiens
Gene DERL2, UniProt Q9GZP9
>NP_001291708.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|derlin-2 isoform c
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQVLQLDTYIFSWKMYFPINLVE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.56 | 0.564209830720774 | 0.016 | 25649146 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)