Host taxon 9606
Protein NP_001017920.2
death-associated protein-like 1
Homo sapiens
Gene DAPL1, UniProt A0PJW8
>NP_001017920.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|death-associated protein-like 1
MANEVQDLLSPRKGGHPPAVKAGGMRISKKQEIGTLERHTKKTGFEKTSAIANVAKIQTLDALNDALEKLNYKFPATVHMAHQKPTPALEKVVPLKRIYIIQQPRKC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.44 | 1.44209135920379 | 0.017 | 25649146 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)