Host taxon 9606
Protein NP_004365.1
cytochrome c oxidase subunit 6C
Homo sapiens
Gene COX6C, UniProt P09669
>NP_004365.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome c oxidase subunit 6C
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.86 | -0.861449016310745 | 1.6e-6 | 25649146 | |
Retrieved 1 of 2 entries in 0.5 ms
(Link to these results)