Host taxon 9606
Protein NP_001853.2
cytochrome c oxidase subunit 5B, mitochondrial precursor
Homo sapiens
Gene COX5B, UniProt P10606
>NP_001853.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome c oxidase subunit 5B, mitochondrial precursor
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.82 | -0.820690765807602 | 3.2e-6 | 25649146 | |
Retrieved 1 of 1 entries in 2.1 ms
(Link to these results)