Host taxon 9606
Protein NP_001305715.1
cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 1 precursor
Homo sapiens
Gene COX4I1, UniProt P13073
>NP_001305715.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome c oxidase subunit 4 isoform 1, mitochondrial isoform 1 precursor
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.48 | -0.477336564166025 | 1.1e-5 | 25649146 | |
Retrieved 1 of 3 entries in 1.9 ms
(Link to these results)