Host taxon 9606
Protein NP_001026788.1
cytochrome c oxidase assembly protein COX19
Homo sapiens
Gene COX19, UniProt Q49B96
>NP_001026788.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome c oxidase assembly protein COX19
MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.93 | -0.933506604909923 | 5.1e-10 | 25649146 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)