Host taxon 9606
Protein NP_001083060.1
cytochrome b-c1 complex subunit 6-like, mitochondrial
Homo sapiens
Gene UQCRHL, UniProt A0A096LP55
>NP_001083060.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome b-c1 complex subunit 6-like, mitochondrial
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.54 | -0.538433370696106 | 0.015 | 25649146 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)