Host taxon 9606
Protein NP_005995.2
cytochrome b-c1 complex subunit 6, mitochondrial isoform 1 precursor
Homo sapiens
Gene UQCRH, UniProt P07919
>NP_005995.2|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cytochrome b-c1 complex subunit 6, mitochondrial isoform 1 precursor
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ -0.55 | -0.545345031582674 | 7.9e-6 | 25649146 | |
Retrieved 1 of 2 entries in 2.2 ms
(Link to these results)