Host taxon 9606
Protein NP_000090.1
cystatin-C precursor
Homo sapiens
Gene CST3, UniProt P01034
>NP_000090.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cystatin-C precursor
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.88 | 0.880505366544765 | 0.019 | 25649146 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)