Host taxon 9606
Protein NP_005204.1
cystatin-A
Homo sapiens
Gene CSTA, UniProt P01040
>NP_005204.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|cystatin-A
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1.32 | -1.32309009992315 | 0.00018 | 25649146 | |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)