Host taxon 9606
Protein NP_001193992.1
coxsackievirus and adenovirus receptor isoform 2 precursor
Homo sapiens
Gene CXADR, UniProt P78310
>NP_001193992.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|coxsackievirus and adenovirus receptor isoform 2 precursor
MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAGKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLNALLRVRLSHLLR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.89 | 0.892129633252446 | 0.046 | 25649146 | |
Retrieved 1 of 1 entries in 4.4 ms
(Link to these results)