Host taxon 9606
Protein NP_872329.1
COX assembly mitochondrial protein homolog isoform 4
Homo sapiens
Gene CMC1, UniProt Q7Z7K0
>NP_872329.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|COX assembly mitochondrial protein homolog isoform 4
MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●○○○○ 0.6 | 0.600494301324175 | 0.0013 | 25649146 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)