Host taxon 9606
Protein NP_001276011.1
CMRF35-like molecule 1 isoform 2
Homo sapiens
Gene CD300LF, UniProt Q8TDQ1
>NP_001276011.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|CMRF35-like molecule 1 isoform 2
MWLPQLDLMRVISAKSQGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNSSRDVPRAGTAAPGGRPLLCRPDPAAGRNLPAKGYHEAFLCPG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ -1 | -1.00479092741459 | 0.0026 | 25649146 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)