Host taxon 9606
Protein NP_612419.1
CKLF-like MARVEL transmembrane domain-containing protein 7 isoform a
Homo sapiens
Gene CMTM7, UniProt Q96FZ5
>NP_612419.1|Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733|CKLF-like MARVEL transmembrane domain-containing protein 7 isoform a
MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Mycobacterium tuberculosis variant bovis BCG str. ATCC 35733 | 998090 | infected host | Human thp-1 cells | 24 h | ●●○○○ 1.05 | 1.04681449924214 | 0.00038 | 25649146 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)